PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10001679m
Common NameCICLE_v10001679mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 351aa    MW: 38669 Da    PI: 8.0724
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10001679mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.1e-32145198255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Ciclev10001679m 145 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 198
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15142199IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-28143199IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-23145198IPR006447Myb domain, plants
PfamPF002492.3E-7146197IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MFSSMNPLIR TASLSPMPDL SLQISPPSAS DCEANNNKEV RFDGLVRNSY AFYSDGGSTT  60
DSASSGSDLS HENRFYNPAE RSYNLGPSEP MLSLGFEMAD LCPPPPQQLP RTINHHQQYQ  120
PQIHGHEFKR NARMISGVKR SVRAPRMRWT TTLHAHFVHA VQLLGGHERA TPKSVLELMN  180
VKDLTLAHVK SHLQMYRTVK STDKGSGQGQ TDMGLNQRTG VVDLEGGLSC AKSDTNSSLH  240
PTPSSPQATS QQKRQRGSLP SMETNNRSIS NSGNAMTYSH FKANDTKGDG RKTAVHMSDN  300
NKVEVERLDS SSLTASDDKL LNLEFTLGRP SWQMDYADQS SNHELTLLHC *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2719891e-91KP271989.1 UNVERIFIED: Populus trichocarpa isolate Potri.014G037200_BESC-125 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006434889.10.0hypothetical protein CICLE_v10001679mg
TrEMBLV4V7S20.0V4V7S2_9R
STRINGVIT_18s0001g11390.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.12e-70G2-like family protein